PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV29207.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family SRS
Protein Properties Length: 355aa    MW: 37290.1 Da    PI: 6.6127
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV29207.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702220.73.2e-681292803154
      DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaeskkel 100
                  g++sCqdCGnqakkdCa++RCRtCCksrgf+C+thvkstWvpaakrrerqqql+ ++++++ ++ +e+ + ++++++ +++ +l++t ++ +++ + l
  KZV29207.1 129 GGGISCQDCGNQAKKDCAYMRCRTCCKSRGFSCQTHVKSTWVPAAKRRERQQQLSGLQQNSNDQEnRESITGKRQRENPSASITLACTGVVPTTT-SGL 226
                 5789***************************************************9999887776344445444445688888888988877765.589 PP

      DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 e  +lP+ev s+avfrcv+vs++dd+e+++aYqt v+i+GhvfkGiLydqG+e+
  KZV29207.1 227 ELGNLPSEVTSQAVFRCVKVSAIDDAEDHYAYQTEVNISGHVFKGILYDQGTES 280
                 999************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.5E-65131279IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.5E-27133175IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.6E-26231277IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAGFFSLGGG GGGGEGRRGG SGGVGGGSGN PDQENTSHNN PPSEINPESW FLFRNEEIQY  60
KGFELWQPQP PQHPHQAENF LQRGGIGNPL QDLYASAGGL AVGPSRGSGF NILDESPRSG  120
FLMMKSSGGG GISCQDCGNQ AKKDCAYMRC RTCCKSRGFS CQTHVKSTWV PAAKRRERQQ  180
QLSGLQQNSN DQENRESITG KRQRENPSAS ITLACTGVVP TTTSGLELGN LPSEVTSQAV  240
FRCVKVSAID DAEDHYAYQT EVNISGHVFK GILYDQGTES HYMAAGETSS GGGSVSAGVQ  300
QLNLITGTSA TATSAATTSA ALGGSSASLF LDPSLYPAPI NSFMAGTQFF PPPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100954.11e-160PREDICTED: protein SHORT INTERNODES
SwissprotQ9XGX07e-92SHI_ARATH; Protein SHORT INTERNODES
TrEMBLS8C9901e-138S8C990_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000093071e-106(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.17e-72Lateral root primordium (LRP) protein-related